Lineage for d2ifxa1 (2ifx A:1-108)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907153Family d.58.4.19: MmlI-like [160292] (2 proteins)
    Pfam PF09448; Methylmuconolactone methyl-isomerase
  6. 1907154Protein Hypothetical protein Reut_A1503 [160293] (1 species)
  7. 1907155Species Ralstonia eutropha [TaxId:106590] [160294] (1 PDB entry)
    Uniprot Q471R3 1-108
  8. 1907156Domain d2ifxa1: 2ifx A:1-108 [147653]
    complexed with cl, gol

Details for d2ifxa1

PDB Entry: 2ifx (more details), 2 Å

PDB Description: crystal structure of a putative 4-methylmuconolactone methylisomerase (yp_295714.1) from ralstonia eutropha jmp134 at 2.00 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ifxa1:

Sequence, based on SEQRES records: (download)

>d2ifxa1 d.58.4.19 (A:1-108) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdigh
vdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag

Sequence, based on observed residues (ATOM records): (download)

>d2ifxa1 d.58.4.19 (A:1-108) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvpffdighvda
igecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag

SCOPe Domain Coordinates for d2ifxa1:

Click to download the PDB-style file with coordinates for d2ifxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ifxa1: