Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.21: YiiX-like [159855] (1 protein) Pfam PF06520; DUF1105; circularly permuted active site residues compare to papain |
Protein Hypothetical protein YiiX [159856] (1 species) |
Species Escherichia coli [TaxId:562] [159857] (1 PDB entry) Uniprot Q8X778 19-200 |
Domain d2if6a1: 2if6 A:19-200 [147651] complexed with unx |
PDB Entry: 2if6 (more details), 1.8 Å
SCOPe Domain Sequences for d2if6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2if6a1 d.3.1.21 (A:19-200) Hypothetical protein YiiX {Escherichia coli [TaxId: 562]} wqpqtgdiifqisrssqskaiqlathsdyshtgmlvmrnkkpyvfeavgpvkytplkqwi ahgekgkyvvrrvegglsveqqqklaqtakrylgkpydfsfswsddrqycsevvwkvyqn algmrvgeqqklkefdlsnplvqaklkerygknipleetvvspqavfdapqlttvakewp lf
Timeline for d2if6a1: