Lineage for d2if6a1 (2if6 A:19-200)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399675Family d.3.1.21: YiiX-like [159855] (1 protein)
    Pfam PF06520; DUF1105; circularly permuted active site residues compare to papain
  6. 1399676Protein Hypothetical protein YiiX [159856] (1 species)
  7. 1399677Species Escherichia coli [TaxId:562] [159857] (1 PDB entry)
    Uniprot Q8X778 19-200
  8. 1399678Domain d2if6a1: 2if6 A:19-200 [147651]
    complexed with unx

Details for d2if6a1

PDB Entry: 2if6 (more details), 1.8 Å

PDB Description: crystal structure of metalloprotein yiix from escherichia coli o157:h7, duf1105
PDB Compounds: (A:) Hypothetical protein yiiX

SCOPe Domain Sequences for d2if6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2if6a1 d.3.1.21 (A:19-200) Hypothetical protein YiiX {Escherichia coli [TaxId: 562]}
wqpqtgdiifqisrssqskaiqlathsdyshtgmlvmrnkkpyvfeavgpvkytplkqwi
ahgekgkyvvrrvegglsveqqqklaqtakrylgkpydfsfswsddrqycsevvwkvyqn
algmrvgeqqklkefdlsnplvqaklkerygknipleetvvspqavfdapqlttvakewp
lf

SCOPe Domain Coordinates for d2if6a1:

Click to download the PDB-style file with coordinates for d2if6a1.
(The format of our PDB-style files is described here.)

Timeline for d2if6a1: