Lineage for d2ieaa3 (2iea A:701-886)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880616Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 2880617Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 2880618Species Escherichia coli [TaxId:562] [75240] (8 PDB entries)
  8. 2880627Domain d2ieaa3: 2iea A:701-886 [137296]
    Other proteins in same PDB: d2ieaa1, d2ieaa2, d2ieab1, d2ieab2
    automated match to d1l8aa3
    complexed with mg, tdp

Details for d2ieaa3

PDB Entry: 2iea (more details), 1.85 Å

PDB Description: e. coli pyruvate dehydrogenase
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2ieaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ieaa3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d2ieaa3:

Click to download the PDB-style file with coordinates for d2ieaa3.
(The format of our PDB-style files is described here.)

Timeline for d2ieaa3: