Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Transcriptional regulator TM1030 [140209] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries) Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75 |
Domain d2id6a1: 2id6 A:-1-75 [147624] Other proteins in same PDB: d2id6a2 complexed with edo |
PDB Entry: 2id6 (more details), 1.75 Å
SCOPe Domain Sequences for d2id6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id6a1 a.4.1.9 (A:-1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} ghmlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsv teklqkefenflmknrn
Timeline for d2id6a1: