Lineage for d2id6a1 (2id6 A:-1-75)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Transcriptional regulator TM1030 [140209] (1 species) Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
Domain d2id6a1: 2id6 A:-1-75 [147624]
Other proteins in same PDB: d2id6a2
complexed with edo
Details for d2id6a1
PDB Entry: 2id6 (more details), 1.75 Å
PDB Description: crystal structure of transcriptional regulator (tm1030) at 1.75a resolution
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILYSCOPe Domain Sequences for d2id6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id6a1 a.4.1.9 (A:-1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
ghmlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsv
teklqkefenflmknrn
SCOPe Domain Coordinates for d2id6a1:
Click to download the PDB-style file with coordinates for d2id6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2id6a1:
- d2id6a1 first appeared in SCOP 1.75
- d2id6a1 appears in SCOPe 2.02
- d2id6a1 appears in SCOPe 2.04
- d2id6a1 appears in the current release, SCOPe 2.08
View in 3D
