Lineage for d2id3a1 (2id3 A:13-80)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305876Protein Putative transcriptional regulator SCO5951 [140179] (1 species)
  7. 2305877Species Streptomyces coelicolor [TaxId:1902] [140180] (1 PDB entry)
    Uniprot O54180 13-80
  8. 2305878Domain d2id3a1: 2id3 A:13-80 [137261]
    Other proteins in same PDB: d2id3a2, d2id3b2
    complexed with ca, cl

Details for d2id3a1

PDB Entry: 2id3 (more details), 1.7 Å

PDB Description: crystal structure of transcriptional regulator sco5951 from streptomyces coelicolor a3(2)
PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2id3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]}
ggrtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadllad
maeqslpr

SCOPe Domain Coordinates for d2id3a1:

Click to download the PDB-style file with coordinates for d2id3a1.
(The format of our PDB-style files is described here.)

Timeline for d2id3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2id3a2