Lineage for d2icyb2 (2icy B:7-383)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins) Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries)
Uniprot Q9M9P3 6-383
Domain d2icyb2: 2icy B:7-383 [137260]
Other proteins in same PDB: d2icya1, d2icyb1
automated match to d2icyb2
complexed with dms, upg
has additional subdomain(s) that are not in the common domain
Details for d2icyb2
PDB Entry: 2icy (more details), 1.64 Å
PDB Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UDP-glucose
PDB Compounds: (B:) Probable UTP-glucose-1-phosphate uridylyltransferase 2SCOPe Domain Sequences for d2icyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icyb2 c.68.1.5 (B:7-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpv
sqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkyg
ckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkeg
wyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycme
vtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikk
lveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdll
lvqsdlytlvdgfvtrn
SCOPe Domain Coordinates for d2icyb2:
Click to download the PDB-style file with coordinates for d2icyb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2icyb2:
- d2icyb2 first appeared in SCOP 1.73
- d2icyb2 appears in SCOPe 2.07
View in 3D
