Lineage for d2icyb1 (2icy B:384-469)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814014Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 2814054Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)
  7. 2814055Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)
    Uniprot Q9M9P3 384-469
  8. 2814057Domain d2icyb1: 2icy B:384-469 [137259]
    Other proteins in same PDB: d2icya2, d2icyb2
    automated match to d2icyb1
    complexed with dms, upg
    has additional insertions and/or extensions that are not grouped together

Details for d2icyb1

PDB Entry: 2icy (more details), 1.64 Å

PDB Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UDP-glucose
PDB Compounds: (B:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOPe Domain Sequences for d2icyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icyb1 b.81.1.4 (B:384-469) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningpedl

SCOPe Domain Coordinates for d2icyb1:

Click to download the PDB-style file with coordinates for d2icyb1.
(The format of our PDB-style files is described here.)

Timeline for d2icyb1:

2814057
d2icyb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2icyb2