Lineage for d2icpa1 (2icp A:8-94)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913672Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 913673Protein Antitoxin HigA [158465] (1 species)
    Uncharacterized transcriptional regulator YddM
  7. 913674Species Escherichia coli [TaxId:562] [158466] (2 PDB entries)
    Uniprot P67699 8-94
  8. 913676Domain d2icpa1: 2icp A:8-94 [147604]
    complexed with mg

Details for d2icpa1

PDB Entry: 2icp (more details), 1.88 Å

PDB Description: crystal structure of the bacterial antitoxin higa from escherichia coli at ph 4.0. northeast structural genomics consortium target er390.
PDB Compounds: (A:) antitoxin higa

SCOPe Domain Sequences for d2icpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icpa1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]}
rpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvigsspqmw
lnlqnawslaeaektvdvsrlrrlvtq

SCOPe Domain Coordinates for d2icpa1:

Click to download the PDB-style file with coordinates for d2icpa1.
(The format of our PDB-style files is described here.)

Timeline for d2icpa1: