Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins) automatically mapped to Pfam PF01979 |
Protein Guanine deaminase [159391] (3 species) |
Species Clostridium acetobutylicum [TaxId:1488] [159392] (1 PDB entry) Uniprot Q97MB6 64-373 CAC0282 |
Domain d2i9ua2: 2i9u A:67-376 [147573] Other proteins in same PDB: d2i9ua1, d2i9ub1 complexed with fe, gol, gun |
PDB Entry: 2i9u (more details), 2.05 Å
SCOPe Domain Sequences for d2i9ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} pgmndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlikdlikng ttrvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslndteeiil kykdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavvkslhkk snfygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgsgmmpvr kylnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseafymatkk ggsffgkvgs
Timeline for d2i9ua2: