Lineage for d2i9ua1 (2i9u A:9-66,A:377-427)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810354Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1810355Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1810476Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)
  6. 1810477Protein Guanine deaminase [159336] (3 species)
  7. 1810480Species Clostridium acetobutylicum [TaxId:1488] [159339] (1 PDB entry)
    Uniprot Q97MB6 6-63,374-424
  8. 1810481Domain d2i9ua1: 2i9u A:9-66,A:377-427 [147572]
    Other proteins in same PDB: d2i9ua2, d2i9ub2
    complexed with fe, gol, gun

Details for d2i9ua1

PDB Entry: 2i9u (more details), 2.05 Å

PDB Description: crystal structure of guanine deaminase from c. acetobutylicum with bound guanine in the active site
PDB Compounds: (A:) Cytosine/guanine deaminase related protein

SCOPe Domain Sequences for d2i9ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ua1 b.92.1.4 (A:9-66,A:377-427) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]}
nlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiiXf
eegydfdalvindsnlypedydlterlerfiylgddrnimkryvcgneif

SCOPe Domain Coordinates for d2i9ua1:

Click to download the PDB-style file with coordinates for d2i9ua1.
(The format of our PDB-style files is described here.)

Timeline for d2i9ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i9ua2