Details for d2i9be1

PDB Entry: 2i9b (more details), 2.8 Å

PDB Compounds: (E:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d2i9be1:

Sequence, based on SEQRES records: (download)

>d2i9be1 g.7.1.3 (E:188-277) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
pqngrqcysckgqsthgcsseetflidcrgpmnqclvatgthepkqqsymvrgcatasmc
qhahlgdafsmnhidvscctksgcnhpdld

Sequence, based on observed residues (ATOM records): (download)

>d2i9be1 g.7.1.3 (E:188-277) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
pqngrqcysckgqsthgcsseetflidcrgpmnqclvatgthepkqqsymvrgcatasah
lgdafsmnhidvscctksgcnhpdld

SCOPe Domain Coordinates for d2i9be1:

Timeline for d2i9be1:

• d2i9be1 first appeared in SCOP 1.75
  
• d2i9be1 appears in SCOPe 2.07
  

Thumbnails for d2i9be1:

d2i9be1 (click for larger image) View in 3D

d2i9be1 in context of chain d2i9be2 in context of chain d2i9be3 in context of chain d2i9be4 in context of chain View in 3D Domains from same chain: (mouse over for more information) d2i9be2, d2i9be3, d2i9be4

d2i9be1 in context of PDB d2i9ba1 in context of PDB d2i9ba2 in context of PDB d2i9bb1 in context of PDB d2i9bb2 in context of PDB d2i9bc1 in context of PDB d2i9bc2 in context of PDB d2i9bd1 in context of PDB d2i9bd2 in context of PDB d2i9bf1 in context of PDB d2i9bf2 in context of PDB d2i9bf3 in context of PDB d2i9bf4 in context of PDB d2i9bg1 in context of PDB d2i9bg2 in context of PDB d2i9bg3 in context of PDB d2i9bh1 in context of PDB d2i9bh2 in context of PDB d2i9bh3 in context of PDB View in 3D Domains from other chains: (mouse over for more information) d2i9ba1, d2i9ba2, d2i9bb1, d2i9bb2, d2i9bc1, d2i9bc2, d2i9bd1, d2i9bd2, d2i9bf1, d2i9bf2, d2i9bf3, d2i9bf4, d2i9bg1, d2i9bg2, d2i9bg3, d2i9bh1, d2i9bh2, d2i9bh3