Lineage for d2i7ka_ (2i7k A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731913Domain d2i7ka_: 2i7k A: [242093]
    automated match to d4lc2a_

Details for d2i7ka_

PDB Entry: 2i7k (more details)

PDB Description: solution structure of the bromodomain of human brd7 protein
PDB Compounds: (A:) Bromodomain-containing protein 7

SCOPe Domain Sequences for d2i7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7ka_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meeveqtplqealnqlmrqlqrkdpsaffsfpvtdfiapgysmiikhpmdfstmkekikn
ndyqsieelkdnfklmctnamiynkpetiyykaakkllhsgmkilsqerlehhhhhh

SCOPe Domain Coordinates for d2i7ka_:

Click to download the PDB-style file with coordinates for d2i7ka_.
(The format of our PDB-style files is described here.)

Timeline for d2i7ka_: