Lineage for d2i76a1 (2i76 A:155-257)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498032Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1498033Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1498190Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
    similar dimer to the class I KARI
  6. 1498191Protein Hypothetical protein TM1727 [158734] (1 species)
  7. 1498192Species Thermotoga maritima [TaxId:2336] [158735] (1 PDB entry)
    Uniprot Q9X250 155-257
  8. 1498193Domain d2i76a1: 2i76 A:155-257 [147535]
    Other proteins in same PDB: d2i76a2, d2i76b1, d2i76b2
    complexed with ndp

Details for d2i76a1

PDB Entry: 2i76 (more details), 3 Å

PDB Description: crystal structure of protein tm1727 from thermotoga maritima
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2i76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i76a1 a.100.1.10 (A:155-257) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}
kkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikkmrvecsltg
pvkrgdwqvveeerreyekifgntvlydeivkllrevaeserr

SCOPe Domain Coordinates for d2i76a1:

Click to download the PDB-style file with coordinates for d2i76a1.
(The format of our PDB-style files is described here.)

Timeline for d2i76a1:

1498193
d2i76a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2i76a2