Lineage for d2i53a1 (2i53 A:14-157)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718479Protein Cyclin K [158591] (1 species)
  7. 2718480Species Human (Homo sapiens) [TaxId:9606] [158592] (1 PDB entry)
    Uniprot O75909 14-157! Uniprot O75909 158-267
  8. 2718481Domain d2i53a1: 2i53 A:14-157 [147505]
    complexed with act

Details for d2i53a1

PDB Entry: 2i53 (more details), 1.5 Å

PDB Description: Crystal structure of Cyclin K
PDB Compounds: (A:) Cyclin K

SCOPe Domain Sequences for d2i53a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]}
sanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlat
giiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfg
ddpkeevmvlerillqtikfdlqv

SCOPe Domain Coordinates for d2i53a1:

Click to download the PDB-style file with coordinates for d2i53a1.
(The format of our PDB-style files is described here.)

Timeline for d2i53a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i53a2