Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.149: AtpF-like [159467] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.149.1: AtpF-like [159468] (2 families) automatically mapped to Pfam PF01990 |
Family c.149.1.1: AtpF-like [159469] (2 proteins) Pfam PF01990; segment-swapping in some members |
Protein V-type ATP synthase subunit F, AtpF [159470] (4 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [159472] (1 PDB entry) Uniprot O29102 4-79 |
Domain d2i4ra1: 2i4r A:4-79 [147501] Other proteins in same PDB: d2i4ra2, d2i4rb3 |
PDB Entry: 2i4r (more details), 2.8 Å
SCOPe Domain Sequences for d2i4ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i4ra1 c.149.1.1 (A:4-79) V-type ATP synthase subunit F, AtpF {Archaeoglobus fulgidus [TaxId: 2234]} lavvgdpdftigfmlagisdiyevtsdeeivkavedvlkrddvgvvimkqeylkklppvl rreidekveptfvsvg
Timeline for d2i4ra1: