Lineage for d2i3da1 (2i3d A:2-219)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.36: Atu1826-like [159742] (2 proteins) Protein Hypothetical protein Atu1826 [159745] (1 species) Species Agrobacterium tumefaciens [TaxId:358] [159746] (1 PDB entry)
Uniprot Q8UED4 2-219
Domain d2i3da1: 2i3d A:2-219 [147499]
complexed with cl, mg
Details for d2i3da1
PDB Entry: 2i3d (more details), 1.5 Å
PDB Description: Crystal Structure of Protein of Unknown Function ATU1826, a Putative Alpha/Beta Hydrolase from Agrobacterium tumefaciens
PDB Compounds: (A:) Hypothetical protein Atu1826SCOPe Domain Sequences for d2i3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}
pevifngpagrlegryqpskeksapiaiilhphpqfggtmnnqivyqlfylfqkrgfttl
rfnfrsigrsqgefdhgagelsdaasaldwvqslhpdskscwvagysfgawigmqllmrr
peiegfmsiapqpntydfsflapcpssgliingdadkvapekdvnglveklktqkgilit
hrtlpganhffngkvdelmgecedyldrrlngelvpep
SCOPe Domain Coordinates for d2i3da1:
Click to download the PDB-style file with coordinates for d2i3da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i3da1:
- d2i3da1 first appeared in SCOP 1.75
- d2i3da1 appears in SCOPe 2.07
View in 3D
