Lineage for d2i2sa_ (2i2s A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
automatically mapped to Pfam PF00426
Protein automated matches [190699] (2 species)
not a true protein
Species Rotavirus c [TaxId:10913] [187837] (1 PDB entry) 
Domain d2i2sa_: 2i2s A: [165375]
automated match to d1kqra_
complexed with gol, mna, mpd, na, so4
Details for d2i2sa_
PDB Entry: 2i2s (more details), 2.3 Å
PDB Description: crystal structure of the porcine crw-8 rotavirus vp8* carbohydrate- recognising domain
PDB Compounds: (A:) Outer capsid protein VP4SCOPe Domain Sequences for d2i2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2sa_ b.29.1.14 (A:) automated matches {Rotavirus c [TaxId: 10913]}
gslldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynl
fgqqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngtt
pnattgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
SCOPe Domain Coordinates for d2i2sa_:
Click to download the PDB-style file with coordinates for d2i2sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i2sa_:
- d2i2sa_ first appeared in SCOPe 2.01
- d2i2sa_ appears in SCOPe 2.04
- d2i2sa_ is called d2i2sa1 in SCOPe 2.06
- d2i2sa_ appears in the current release, SCOPe 2.08, called d2i2sa1
View in 3D
