Lineage for d2i26n1 (2i26 N:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741840Protein Novel antigen receptor (against lysozyme) [110042] (1 species)
  7. 2741841Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries)
    Uniprot Q8AXI4 # fragment
  8. 2741845Domain d2i26n1: 2i26 N:2-112 [145417]
    Other proteins in same PDB: d2i26l_, d2i26m_, d2i26n2, d2i26o2, d2i26o3, d2i26p2, d2i26p3, d2i26q_
    complexed with so4

Details for d2i26n1

PDB Entry: 2i26 (more details), 2.5 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme
PDB Compounds: (N:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i26n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i26n1 b.1.1.1 (N:2-112) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvn

SCOPe Domain Coordinates for d2i26n1:

Click to download the PDB-style file with coordinates for d2i26n1.
(The format of our PDB-style files is described here.)

Timeline for d2i26n1:

2741845
d2i26n1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2i26n2