Lineage for d2i25o_ (2i25 O:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513442Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)
  8. 1513445Domain d2i25o_: 2i25 O: [161459]
    Other proteins in same PDB: d2i25l_, d2i25m_
    automated match to d2i26n1

Details for d2i25o_

PDB Entry: 2i25 (more details), 1.8 Å

PDB Description: Crystal structure analysis of the nurse shark New antigen Receptor PBLA8 variable domain in complex with lysozyme
PDB Compounds: (O:) New Antigen Receptor PBLA8

SCOPe Domain Sequences for d2i25o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i25o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqritketgesltincvvrdsrcvlstgywyrkppgsrneesisdggryvetvnr
gsksfslrindltvkdsgtyrckpesrygsydavcaalndqygggtvvtvnaaahhh

SCOPe Domain Coordinates for d2i25o_:

Click to download the PDB-style file with coordinates for d2i25o_.
(The format of our PDB-style files is described here.)

Timeline for d2i25o_: