Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries) |
Domain d2i25o_: 2i25 O: [161459] Other proteins in same PDB: d2i25l_, d2i25m_ automated match to d2i26n1 |
PDB Entry: 2i25 (more details), 1.8 Å
SCOPe Domain Sequences for d2i25o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i25o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} rvdqtpqritketgesltincvvrdsrcvlstgywyrkppgsrneesisdggryvetvnr gsksfslrindltvkdsgtyrckpesrygsydavcaalndqygggtvvtvnaaahhh
Timeline for d2i25o_: