Lineage for d2i1yb_ (2i1y B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483697Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2483698Protein automated matches [190475] (10 species)
    not a true protein
  7. 2483713Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2483813Domain d2i1yb_: 2i1y B: [204685]
    automated match to d1oesa_
    complexed with gol

Details for d2i1yb_

PDB Entry: 2i1y (more details), 2.23 Å

PDB Description: crystal structure of the phosphatase domain of human ptp ia-2
PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase

SCOPe Domain Sequences for d2i1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i1yb_ c.45.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdistghmilaymedhlrnrdrlakewqalcayqaepntcataqgegnikknrhpdflpy
dhariklkvesspsrsdyinaspiiehdprmpayiatqgplshtiadfwqmvwesgctvi
vmltplvedgvkqcdrywpdegaslyhvyevnlvsehiwcedflvrsfylknvqtqetrt
ltqfhflswpaegtpastrplldfrrkvnkcyrgrscpiivhcsdgagrtgtyilidmvl
nrmakgvkeidiaatlehvrdqrpglvrskdqfefaltavaeevnailka

SCOPe Domain Coordinates for d2i1yb_:

Click to download the PDB-style file with coordinates for d2i1yb_.
(The format of our PDB-style files is described here.)

Timeline for d2i1yb_: