Lineage for d2i14a2 (2i14 A:1-110)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) (S)
  5. Family d.41.2.1: NadC N-terminal domain-like [54676] (4 proteins)
  6. Protein Nicotinate-nucleotide pyrophosphorylase PF1904 [143195] (1 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [143196] (1 PDB entry)
    Uniprot Q8TZS9 1-110
  8. Domain d2i14a2: 2i14 A:1-110 [136967]
    Other proteins in same PDB: d2i14a1, d2i14b1, d2i14c1, d2i14d1, d2i14e1, d2i14f1
    complexed with pcp, zn

Details for d2i14a2

PDB Entry: 2i14 (more details), 2.9 Å

PDB Description: Crystal structure of nicotinate-nucleotide pyrophosphorylase from Pyrococcus furiosus
PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d2i14a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i14a2 d.41.2.1 (A:1-110) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]}
mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmls

SCOPe Domain Coordinates for d2i14a2 are not available.

Timeline for d2i14a2:

Domains from same chain:
(mouse over for more information)
d2i14a1
Domains from other chains:
(mouse over for more information)
d2i14b1, d2i14b2, d2i14c1, d2i14c2, d2i14d1, d2i14d2, d2i14e1, d2i14e2, d2i14f1, d2i14f2