Lineage for d2i0xa1 (2i0x A:1-84)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562976Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2562977Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins)
    Pfam PF09827
  6. 2562987Protein Hypothetical protein PF1117 [160346] (1 species)
  7. 2562988Species Pyrococcus furiosus [TaxId:2261] [160347] (2 PDB entries)
    Uniprot Q8U1T8 1-84
  8. 2562990Domain d2i0xa1: 2i0x A:1-84 [147482]

Details for d2i0xa1

PDB Entry: 2i0x (more details), 2.7 Å

PDB Description: hypothetical protein pf1117 from pyrococcus furiosus
PDB Compounds: (A:) Hypothetical protein PF1117

SCOPe Domain Sequences for d2i0xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0xa1 d.58.58.1 (A:1-84) Hypothetical protein PF1117 {Pyrococcus furiosus [TaxId: 2261]}
myivvvydvgvervnkvkkflrmhlnwvqnsvfegevtlaeferikeglkkiidensdsv
iiyklrsmppretlgieknpieei

SCOPe Domain Coordinates for d2i0xa1:

Click to download the PDB-style file with coordinates for d2i0xa1.
(The format of our PDB-style files is described here.)

Timeline for d2i0xa1: