![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein General stress protein 26 [141352] (1 species) |
![]() | Species Nostoc punctiforme pcc 73102 [TaxId:63737] [141353] (1 PDB entry) |
![]() | Domain d2i02a1: 2i02 A:5-147 [136936] complexed with cl, fmn, p33 |
PDB Entry: 2i02 (more details), 1.8 Å
SCOPe Domain Sequences for d2i02a1:
Sequence, based on SEQRES records: (download)
>d2i02a1 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]} tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall kvninqvnywdstssfkpqtisf
>d2i02a1 b.45.1.1 (A:5-147) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]} tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdeatlwfftyagshkvteie hheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiallkvn inqvnywdstssfkpqtisf
Timeline for d2i02a1: