Lineage for d2hzfb_ (2hzf B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (147 species)
not a true protein
Species Ectromelia virus [TaxId:265874] [187832] (2 PDB entries) 
Domain d2hzfb_: 2hzf B: [165341]
automated match to d1jhba_
Details for d2hzfb_
PDB Entry: 2hzf (more details), 1.8 Å
PDB Description: Crystal structures of a poxviral glutaredoxin in the oxidized and reduced states show redox-correlated structural changes
PDB Compounds: (B:) Glutaredoxin-1SCOPe Domain Sequences for d2hzfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzfb_ c.47.1.0 (B:) automated matches {Ectromelia virus [TaxId: 265874]}
hqmaeefvqqrlannkvtifvkytcpfcrnaldilnkfsfkrgayeivdikefkpenelr
dyfeqitggktvpriffgktsiggysdlleidnmdalgdilssigvlrt
SCOPe Domain Coordinates for d2hzfb_:
Click to download the PDB-style file with coordinates for d2hzfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hzfb_:
- d2hzfb_ first appeared in SCOPe 2.01
- d2hzfb_ appears in SCOPe 2.04
- d2hzfb_ is called d2hzfb1 in SCOPe 2.06
- d2hzfb_ appears in the current release, SCOPe 2.08, called d2hzfb1
View in 3D
