Lineage for d2hyka_ (2hyk A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388754Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2388785Protein Beta-1,3-glucanase [310824] (3 species)
    Pfam PF03935
  7. 2388786Species Nocardiopsis sp. F96 [TaxId:221582] [311091] (1 PDB entry)
  8. 2388787Domain d2hyka_: 2hyk A: [304046]
    complexed with ca, eoh, gol, so4

Details for d2hyka_

PDB Entry: 2hyk (more details), 1.3 Å

PDB Description: the crystal structure of an endo-beta-1,3-glucanase from alkaliphilic nocardiopsis sp.strain f96
PDB Compounds: (A:) Beta-1,3-glucanase

SCOPe Domain Sequences for d2hyka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyka_ b.29.1.2 (A:) Beta-1,3-glucanase {Nocardiopsis sp. F96 [TaxId: 221582]}
atlvwsdefdgpagsapdpanwnhetgdhgwgnnelqnytdsransaldgngnlvitarq
eadggytsarlttqnkvqpqygrveasiqiprgqgiwpafwmlgadfpntpwpdsgeidi
menigrephlvhgslhgpgyfggepltgsymhpqgwsfadtfhtfavdwrpgsitwsvdg
vayqtytsadtrgnpwvfdqpffmilnvavggdwpgypdgstqfpqemrvdyvrvye

SCOPe Domain Coordinates for d2hyka_:

Click to download the PDB-style file with coordinates for d2hyka_.
(The format of our PDB-style files is described here.)

Timeline for d2hyka_: