Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Probable ATP-dependent RNA helicase DDX48 [142314] (1 species) Eukaryotic translation initiation factor 4A isoform 3 |
Species Human (Homo sapiens) [TaxId:9606] [142315] (2 PDB entries) Uniprot P38919 22-243! Uniprot P38919 244-411 |
Domain d2hyic2: 2hyi C:244-411 [136893] Other proteins in same PDB: d2hyia_, d2hyib_, d2hyig_, d2hyih_ protein/RNA complex; complexed with anp, mg |
PDB Entry: 2hyi (more details), 2.3 Å
SCOPe Domain Sequences for d2hyic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyic2 c.37.1.19 (C:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih rigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
Timeline for d2hyic2: