Lineage for d2hy5c1 (2hy5 C:402-502)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168471Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2168472Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2168513Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 2168514Protein DsrH [142108] (1 species)
  7. 2168515Species Chromatium vinosum [TaxId:1049] [142109] (2 PDB entries)
    Uniprot O87898 2-102
  8. 2168516Domain d2hy5c1: 2hy5 C:402-502 [136867]
    Other proteins in same PDB: d2hy5a1, d2hy5b1

Details for d2hy5c1

PDB Entry: 2hy5 (more details), 1.72 Å

PDB Description: Crystal structure of DsrEFH
PDB Compounds: (C:) DsrH

SCOPe Domain Sequences for d2hy5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hy5c1 c.114.1.2 (C:402-502) DsrH {Chromatium vinosum [TaxId: 1049]}
silhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyv
lgpdlkargfsdervipgisvvdyagfvdlttecdtvqawl

SCOPe Domain Coordinates for d2hy5c1:

Click to download the PDB-style file with coordinates for d2hy5c1.
(The format of our PDB-style files is described here.)

Timeline for d2hy5c1: