Lineage for d2hy5a1 (2hy5 A:1-130)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528392Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2528393Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2528394Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 2528415Protein Sulfurtransferase DsrE [142098] (1 species)
  7. 2528416Species Chromatium vinosum [TaxId:1049] [142099] (2 PDB entries)
    Uniprot O87896 1-130
  8. 2528417Domain d2hy5a1: 2hy5 A:1-130 [136865]
    Other proteins in same PDB: d2hy5b1, d2hy5c1

Details for d2hy5a1

PDB Entry: 2hy5 (more details), 1.72 Å

PDB Description: Crystal structure of DsrEFH
PDB Compounds: (A:) Putative sulfurtransferase dsrE

SCOPe Domain Sequences for d2hy5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hy5a1 c.114.1.1 (A:1-130) Sulfurtransferase DsrE {Chromatium vinosum [TaxId: 1049]}
mkfalqinegpyqhqasdsayqfakaalekgheifrvffyhdgvnnstrlttppqddrhi
vnrwaelaeqyeldmvvcvaaaqrrgivdegeasrngkdatnihpkfrisglgqlveaai
qadrlvvfgd

SCOPe Domain Coordinates for d2hy5a1:

Click to download the PDB-style file with coordinates for d2hy5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hy5a1: