Lineage for d2hvda_ (2hvd A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204903Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1204904Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1204905Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1204986Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (5 PDB entries)
  8. 1204996Domain d2hvda_: 2hvd A: [136801]
    automated match to d1jxva_
    complexed with adp

Details for d2hvda_

PDB Entry: 2hvd (more details), 2.15 Å

PDB Description: human nucleoside diphosphate kinase a complexed with adp
PDB Compounds: (A:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d2hvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvda_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeiglwfhpeelvdytscaqnwiye

SCOPe Domain Coordinates for d2hvda_:

Click to download the PDB-style file with coordinates for d2hvda_.
(The format of our PDB-style files is described here.)

Timeline for d2hvda_: