Lineage for d2hvba_ (2hvb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769954Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1769955Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 1769978Protein automated matches [190694] (3 species)
    not a true protein
  7. 1770017Species Pyrococcus horikoshii [TaxId:70601] [187828] (1 PDB entry)
  8. 1770018Domain d2hvba_: 2hvb A: [165302]
    automated match to d1do6a_
    complexed with fe

Details for d2hvba_

PDB Entry: 2hvb (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical protein PH1083 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) superoxide reductase

SCOPe Domain Sequences for d2hvba_:

Sequence, based on SEQRES records: (download)

>d2hvba_ b.1.13.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mlketirsgdwkgekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeg
gqfpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle

Sequence, based on observed residues (ATOM records): (download)

>d2hvba_ b.1.13.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mlketirsgdwekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeggq
fpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle

SCOPe Domain Coordinates for d2hvba_:

Click to download the PDB-style file with coordinates for d2hvba_.
(The format of our PDB-style files is described here.)

Timeline for d2hvba_: