Lineage for d2hv6a1 (2hv6 A:22-322)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020686Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2020687Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2020688Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 2020689Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 2020694Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
    Uniprot Q15257 22-322! Uniprot Q15257 23-322
  8. 2020697Domain d2hv6a1: 2hv6 A:22-322 [136784]
    complexed with mg

Details for d2hv6a1

PDB Entry: 2hv6 (more details), 1.9 Å

PDB Description: Crystal structure of the phosphotyrosyl phosphatase activator
PDB Compounds: (A:) Protein phosphatase 2A, regulatory subunit B

SCOPe Domain Sequences for d2hv6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv6a1 a.268.1.1 (A:22-322) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s

SCOPe Domain Coordinates for d2hv6a1:

Click to download the PDB-style file with coordinates for d2hv6a1.
(The format of our PDB-style files is described here.)

Timeline for d2hv6a1: