Lineage for d2hsza1 (2hsz A:1-224)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
the insertion subdomain is a 4-helical bundle
Protein Phosphoglycolate phosphatase Gph [142143] (1 species) Species Haemophilus somnus [TaxId:731] [142144] (1 PDB entry)
Uniprot Q0I1W8 1-224
Domain d2hsza1: 2hsz A:1-224 [136726]
Other proteins in same PDB: d2hszb_
complexed with act, cl, unl
Details for d2hsza1
PDB Entry: 2hsz (more details), 1.9 Å
PDB Description: crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution
PDB Compounds: (A:) novel predicted phosphataseSCOPe Domain Sequences for d2hsza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}
mtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqravd
wackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtnk
ptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqnd
ifaahsagcavvgltygynynipiaqskpdwifddfadilkitq
SCOPe Domain Coordinates for d2hsza1:
Click to download the PDB-style file with coordinates for d2hsza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hsza1:
- d2hsza1 first appeared in SCOP 1.73
- d2hsza1 appears in SCOPe 2.04
- d2hsza1 appears in SCOPe 2.06
- d2hsza1 appears in the current release, SCOPe 2.08
View in 3D
