Lineage for d2hsxa1 (2hsx A:2-116)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1449378Fold d.346: SARS Nsp1-like [160098] (1 superfamily)
    complex alpha+beta fold; contains mixed beta-sheet barrel, n=6, S=10
  4. 1449379Superfamily d.346.1: SARS Nsp1-like [160099] (1 family) (S)
    automatically mapped to Pfam PF11501
  5. 1449380Family d.346.1.1: SARS Nsp1-like [160100] (1 protein)
  6. 1449381Protein Nsp1 [160101] (1 species)
  7. 1449382Species SARS coronavirus [TaxId:227859] [160102] (2 PDB entries)
    Uniprot P59641 13-127
  8. 1449383Domain d2hsxa1: 2hsx A:2-116 [147396]
    automatically matched to 2GDT A:2-116

Details for d2hsxa1

PDB Entry: 2hsx (more details)

PDB Description: nmr structure of the nonstructural protein 1 (nsp1) from the sars coronavirus
PDB Compounds: (A:) Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)

SCOPe Domain Sequences for d2hsxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsxa1 d.346.1.1 (A:2-116) Nsp1 {SARS coronavirus [TaxId: 227859]}
hvqlslpvlqvrdvlvrgfgdsveealsearehlkngtcglvelekgvlpqleqpyvfik
rsdalstnhghkvvelvaemdgiqygrsgitlgvlvphvgetpiayrnvllrkng

SCOPe Domain Coordinates for d2hsxa1:

Click to download the PDB-style file with coordinates for d2hsxa1.
(The format of our PDB-style files is described here.)

Timeline for d2hsxa1: