Lineage for d2hrva_ (2hrv A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) 
Protein 2A cysteine proteinase [50607] (1 species) Species Human rhinovirus 2 [TaxId:12130] [50608] (1 PDB entry) 
Domain d2hrva_: 2hrv A: [26429]
complexed with zn
Details for d2hrva_
PDB Entry: 2hrv (more details), 1.95 Å
PDB Description: 2a cysteine proteinase from human rhinovirus 2
PDB Compounds: (A:) 2a cysteine proteinaseSCOPe Domain Sequences for d2hrva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrva_ b.47.1.4 (A:) 2A cysteine proteinase {Human rhinovirus 2 [TaxId: 12130]}
gpsdmyvhvgnliyrnlhlfnsemhesilvsyssdliiyrtntvgddyipscdctqatyy
ckhknryfpitvtshdwyeiqeseyypkhiqynlligegpcepgdcggkllckhgvigiv
taggdnhvafidlrhfhca
SCOPe Domain Coordinates for d2hrva_:
Click to download the PDB-style file with coordinates for d2hrva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hrva_:
- d2hrva_ first appeared (with stable ids) in SCOP 1.55
- d2hrva_ appears in SCOPe 2.04
- d2hrva_ appears in SCOPe 2.06
- d2hrva_ appears in the current release, SCOPe 2.08
View in 3D
