Lineage for d2hqua_ (2hqu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1809317Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1809467Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1809660Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1809661Protein automated matches [191182] (12 species)
    not a true protein
  7. 1809793Species Human (Homo sapiens) [TaxId:9606] [226031] (4 PDB entries)
  8. 1809806Domain d2hqua_: 2hqu A: [147361]
    automated match to d4apza_
    complexed with cl, dup, mg

Details for d2hqua_

PDB Entry: 2hqu (more details), 2.2 Å

PDB Description: human dutpase in complex with alpha,beta-iminodutp and magnesium ion
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2hqua_:

Sequence, based on SEQRES records: (download)

>d2hqua_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfgstgkn

Sequence, based on observed residues (ATOM records): (download)

>d2hqua_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrraagydlysaydytippmekavvktdiqialpsgcygrvaprs
glaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeieevq
alddtergsggfgstgkn

SCOPe Domain Coordinates for d2hqua_:

Click to download the PDB-style file with coordinates for d2hqua_.
(The format of our PDB-style files is described here.)

Timeline for d2hqua_: