Lineage for d2hq7a1 (2hq7 A:2-142)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794172Protein Hypotheical protein CAC3491 [141360] (1 species)
    related to general stress protein 26(GS26) of B.subtilis
  7. 2794173Species Clostridium acetobutylicum [TaxId:1488] [141361] (1 PDB entry)
    Uniprot Q97DI6 2-142
  8. 2794174Domain d2hq7a1: 2hq7 A:2-142 [136657]
    complexed with cl, edo

Details for d2hq7a1

PDB Entry: 2hq7 (more details), 2 Å

PDB Description: crystal structure of protein related to general stress protein 26(gs26) of b.subtilis (pyridoxinephosphate oxidase family) (np_350077.1) from clostridium acetobutylicum at 2.00 a resolution
PDB Compounds: (A:) Protein, related to general stress protein 26(GS26) of B.subtilis

SCOPe Domain Sequences for d2hq7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hq7a1 b.45.1.1 (A:2-142) Hypotheical protein CAC3491 {Clostridium acetobutylicum [TaxId: 1488]}
idekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmverl
kknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytalcf
taewgnyyrhlknitfkidei

SCOPe Domain Coordinates for d2hq7a1:

Click to download the PDB-style file with coordinates for d2hq7a1.
(The format of our PDB-style files is described here.)

Timeline for d2hq7a1:

2794174
d2hq7a1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2hq7b_