Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (49 species) not a true protein |
Species Leptospira interrogans [TaxId:173] [187817] (1 PDB entry) |
Domain d2hnkc_: 2hnk C: [165161] automated match to d1suia1 complexed with peg, sah, so4 |
PDB Entry: 2hnk (more details), 2.3 Å
SCOPe Domain Sequences for d2hnkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnkc_ c.66.1.0 (C:) automated matches {Leptospira interrogans [TaxId: 173]} rknisltesleeyifrnsvrepdsflklrketgtlaqanmqispeegqflniltkisgak riieigtftgysslcfasalpedgkilccdvseewtnvarkywkenglenkiflklgsal etlqvlidsksapswasdfafgpssidlffldadkenypnyyplilkllkpgglliadnv lwdgsvadlshqepstvgirkfnelvyndslvdvslvpiadgvslvrkrle
Timeline for d2hnkc_: