Lineage for d2hi0b_ (2hi0 B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.0: automated matches [191369] (1 protein)
not a true familyProtein automated matches [190447] (45 species)
not a true protein
Species Lactobacillus delbrueckii [TaxId:1584] [187809] (1 PDB entry) 
Domain d2hi0b_: 2hi0 B: [165116]
automated match to d2hsza1
complexed with act, cl, edo, na
Details for d2hi0b_
PDB Entry: 2hi0 (more details), 1.51 Å
PDB Description: crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution
PDB Compounds: (B:) Putative phosphoglycolate phosphataseSCOPe Domain Sequences for d2hi0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hi0b_ c.108.1.0 (B:) automated matches {Lactobacillus delbrueckii [TaxId: 1584]}
mkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtrala
yeagssreslvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmkn
lrqkgvklavvsnkpneavqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgvp
rdkcvyigdseidiqtarnsemdeiavnwgfrsvpflqkhgatvivdtaekleeailge
SCOPe Domain Coordinates for d2hi0b_:
Click to download the PDB-style file with coordinates for d2hi0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hi0b_:
- d2hi0b_ first appeared in SCOPe 2.01
- d2hi0b_ appears in SCOPe 2.03
- d2hi0b_ appears in SCOPe 2.05
- d2hi0b_ appears in the current release, SCOPe 2.08
View in 3D
