Lineage for d2hg0a2 (2hg0 A:301-400)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamiliesFamily b.1.18.0: automated matches [191341] (1 protein)
not a true familyProtein automated matches [190226] (72 species)
not a true protein
Species West Nile virus [TaxId:11082] [255209] (2 PDB entries) 
Domain d2hg0a2: 2hg0 A:301-400 [242034]
Other proteins in same PDB: d2hg0a1
automated match to d1urza1
complexed with ful, ndg
Details for d2hg0a2
PDB Entry: 2hg0 (more details), 3 Å
PDB Description: structure of the west nile virus envelope glycoprotein
PDB Compounds: (A:) Envelope glycoproteinSCOPe Domain Sequences for d2hg0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg0a2 b.1.18.0 (A:301-400) automated matches {West Nile virus [TaxId: 11082]}
tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp
fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks
SCOPe Domain Coordinates for d2hg0a2:
Click to download the PDB-style file with coordinates for d2hg0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hg0a2:
- d2hg0a2 first appeared in SCOPe 2.04
- d2hg0a2 appears in SCOPe 2.06
- d2hg0a2 appears in the current release, SCOPe 2.08
View in 3D
