| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein Tumor necrosis factor ligand superfamily member 4, OX40L [141127] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [141129] (2 PDB entries) Uniprot P43488 58-185 |
| Domain d2hewf1: 2hew F:58-185 [136364] complexed with nag, so4 |
PDB Entry: 2hew (more details), 1.45 Å
SCOPe Domain Sequences for d2hewf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hewf1 b.22.1.1 (F:58-185) Tumor necrosis factor ligand superfamily member 4, OX40L {Mouse (Mus musculus) [TaxId: 10090]}
ppiqrlrgavtrcedgqlfissykneyqtmevqnnsvvikcdglyiiylkgsffqevkid
lhfredhnpisipmlndgrrivftvvaslafkdkvyltvnapdtlcehlqindgelivvq
ltpgycap
Timeline for d2hewf1: