Lineage for d2he2b_ (2he2 B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domainFamily b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein automated matches [190055] (6 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187785] (42 PDB entries) 
Domain d2he2b_: 2he2 B: [204545]
automated match to d1pdra_
Details for d2he2b_
PDB Entry: 2he2 (more details), 1.5 Å
PDB Description: Crystal structure of the 3rd PDZ domain of human discs large homologue 2, DLG2
PDB Compounds: (B:) Discs large homolog 2SCOPe Domain Sequences for d2he2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2he2b_ b.36.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meprkvvlhkgstglgfnivggedgegifvsfilaggpadlsgelqrgdqilsvngidlr
gasheqaaaalkgagqtvtiiaqyqpedyarfeakihetsv
SCOPe Domain Coordinates for d2he2b_:
Click to download the PDB-style file with coordinates for d2he2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2he2b_:
- d2he2b_ first appeared in SCOPe 2.03
- d2he2b_ appears in SCOPe 2.04
- d2he2b_ is called d2he2b1 in SCOPe 2.06
- d2he2b_ appears in the current release, SCOPe 2.08, called d2he2b1
View in 3D
