Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
Protein Phosphoglycolate phosphatase [142135] (1 species) |
Species Lactobacillus plantarum [TaxId:1590] [142136] (1 PDB entry) Uniprot Q88YA8 1-207 |
Domain d2hdoa1: 2hdo A:1-207 [136345] complexed with po4 |
PDB Entry: 2hdo (more details), 1.5 Å
SCOPe Domain Sequences for d2hdoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} mtyqalmfdidgtltnsqpayttvmrevlatygkpfspaqaqktfpmaaeqamtelgiaa sefdhfqaqyedvmashydqielypgitslfeqlpselrlgivtsqrrnelesgmrsypf mmrmavtisaddtpkrkpdplplltalekvnvapqnalfigdsvsdeqtaqaanvdfgla vwgmdpnadhqkvahrfqkpldilelf
Timeline for d2hdoa1: