Lineage for d2hbxa_ (2hbx A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
Pfam PF04909; Amidohydrolase; stand-alone domain
Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species) Species Pseudomonas fluorescens [TaxId:294] [141825] (10 PDB entries)
Uniprot Q83V25 3-333
Domain d2hbxa_: 2hbx A: [136322]
automated match to d2hbva1
complexed with co
Details for d2hbxa_
PDB Entry: 2hbx (more details), 2.5 Å
PDB Description: crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd)
PDB Compounds: (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylaseSCOPe Domain Sequences for d2hbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbxa_ c.1.9.15 (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffninv
SCOPe Domain Coordinates for d2hbxa_:
Click to download the PDB-style file with coordinates for d2hbxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hbxa_:
- d2hbxa_ first appeared in SCOP 1.73, called d2hbxa1
- d2hbxa_ appears in SCOPe 2.05
- d2hbxa_ appears in SCOPe 2.07
- d2hbxa_ appears in the current release, SCOPe 2.08
View in 3D
