![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.4: PA0793-like [160123] (1 protein) Pfam PF04303; DUF453 |
![]() | Protein Hypothetical protein PA0793 [160124] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [160125] (1 PDB entry) Uniprot Q9I5E5 1-182! Uniprot Q9I5E5 187-395 |
![]() | Domain d2h9fa2: 2h9f A:187-395 [147249] complexed with cl, co, gol, so4 |
PDB Entry: 2h9f (more details), 1.95 Å
SCOPe Domain Sequences for d2h9fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9fa2 d.21.1.4 (A:187-395) Hypothetical protein PA0793 {Pseudomonas aeruginosa [TaxId: 287]} dggaifptgnlvddlevpgvgtfkatminagiptvfvnaeeigyrgtelreeingdpqql arferirvagalrmgliktpeeaatrqhtpkiafvapprdyrtasgklvaagdidllvra lsmgklhhammgtaavaigtaaaipgtlvnlaagggersavrfghpsgtlrvgaeasqan gewtvtkaimsrsarilmegwvrvpgdaf
Timeline for d2h9fa2: