Lineage for d2h8ua_ (2h8u A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259062Protein Bucain [111404] (1 species)
  7. 2259063Species Malayan krait (Bungarus candidus) [TaxId:92438] [111405] (2 PDB entries)
    Uniprot P83346
  8. 2259064Domain d2h8ua_: 2h8u A: [136246]
    automated match to d1vyca_

Details for d2h8ua_

PDB Entry: 2h8u (more details), 2.1 Å

PDB Description: bucain, a cardiotoxin from the malayan krait bungarus candidus
PDB Compounds: (A:) Bucain

SCOPe Domain Sequences for d2h8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8ua_ g.7.1.1 (A:) Bucain {Malayan krait (Bungarus candidus) [TaxId: 92438]}
rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
dkcna

SCOPe Domain Coordinates for d2h8ua_:

Click to download the PDB-style file with coordinates for d2h8ua_.
(The format of our PDB-style files is described here.)

Timeline for d2h8ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h8ub_