Lineage for d2h8fb_ (2h8f B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1977443Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977517Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)
  8. 1977518Domain d2h8fb_: 2h8f B: [136240]
    Other proteins in same PDB: d2h8fa_, d2h8fc_
    automated match to d1hbhb_
    complexed with hem

Details for d2h8fb_

PDB Entry: 2h8f (more details), 1.3 Å

PDB Description: Crystal structure of deoxy hemoglobin from Trematomus bernacchii at pH 6.2
PDB Compounds: (B:) Hemoglobin beta subunit

SCOPe Domain Sequences for d2h8fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d2h8fb_:

Click to download the PDB-style file with coordinates for d2h8fb_.
(The format of our PDB-style files is described here.)

Timeline for d2h8fb_: