Lineage for d2h7wa1 (2h7w A:3-110)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.26: ICP-like [141066] (2 families) 
topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
Family b.1.26.1: ICP-like [141067] (2 proteins)
PfamB PB014070
automatically mapped to Pfam PF09394Protein Chagasin [141068] (1 species) Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
Uniprot Q966X9 3-110
Domain d2h7wa1: 2h7w A:3-110 [136225]
Details for d2h7wa1
PDB Entry: 2h7w (more details), 1.7 Å
PDB Description: crystal structure of chagasin, the endogenous cysteine-protease inhibitor from trypanosoma cruzi
PDB Compounds: (A:) ChagasinSCOPe Domain Sequences for d2h7wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h7wa1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
kllgaggtehfhvtvkaagthavnltymrpwtgpshdserfivylkan
SCOPe Domain Coordinates for d2h7wa1:
Click to download the PDB-style file with coordinates for d2h7wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h7wa1:
- d2h7wa1 first appeared in SCOP 1.73
- d2h7wa1 appears in SCOPe 2.06
- d2h7wa1 appears in the current release, SCOPe 2.08
View in 3D
