Lineage for d2h6ba2 (2h6b A:3-147)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331405Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1331411Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1331466Protein Chlorophenol reduction protein CprK [159314] (2 species)
  7. 1331470Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries)
    Uniprot Q18R04 3-147! Uniprot Q18R04 9-147
  8. 1331482Domain d2h6ba2: 2h6b A:3-147 [147229]
    Other proteins in same PDB: d2h6ba1, d2h6bb1
    protein/DNA complex; complexed with 3c4, so4

Details for d2h6ba2

PDB Entry: 2h6b (more details), 2.2 Å

PDB Description: Crystal structure of oxidized CprK in complex with o-chlorophenolacetic acid
PDB Compounds: (A:) ChloroPhenol Reduction gene K

SCOPe Domain Sequences for d2h6ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6ba2 b.82.3.2 (A:3-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
veglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkik
ldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedm
ifeifknyltkvayyarqvaemnty

SCOPe Domain Coordinates for d2h6ba2:

Click to download the PDB-style file with coordinates for d2h6ba2.
(The format of our PDB-style files is described here.)

Timeline for d2h6ba2:

1331482
d2h6ba2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2h6ba1